PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007275P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 241aa    MW: 25943.8 Da    PI: 8.8403
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007275P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.37.1e-381977361
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     + +kcprCds ntkfCyynnyslsqPry+Ck+CrryWt+GG+lrnvPvGgg+rk k+ 
  MELO3C007275P1 19 PQPQKCPRCDSLNTKFCYYNNYSLSQPRYLCKTCRRYWTHGGTLRNVPVGGGCRKGKRL 77
                    5789***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.5E-332176IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4912276IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-232376IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MQYQDRRLKS VQVQDQVQPQ PQKCPRCDSL NTKFCYYNNY SLSQPRYLCK TCRRYWTHGG  60
TLRNVPVGGG CRKGKRLKQS SQSSNNNSSV KSSLVQTSAS PVLPPPQIVP LSLSTTTSQH  120
VIFSGTPVIT PPSFFNSGGE LLSSSSWINS FGSSSQGPEI IYDMMDQSSG KADANSSSPA  180
AGWSESYINN NSISNPMAAT GDAVVWPAGE NNATLAAATS TNNATINQWP DYMPGFCPPP  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439844.11e-177PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A0A0KLH81e-116A0A0A0KLH8_CUCSA; Uncharacterized protein
STRINGPOPTR_0004s04590.13e-38(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-32OBF binding protein 4